Table 2 MASCOT analysis of protein identification and full sequence of target protein
From: Development and fabrication of disease resistance protein in recombinant Escherichia coli
No | Protein name | Accession no. | Score | Mw (kDa) | PI | Coverage (%) |
|---|---|---|---|---|---|---|
NP-17 | C-phycocyanin beta subunit, Chain B | 1GH0_B | 115 | 18.0 | 4.96 | 30 |
NP-30 | Putative disease resistance protein (DRP), partial | OEL30137 | 141 | 27.8 | 6.20 | 5 |
Protein sequence of DRP | ||||||
MLKDELQRLQGCLKDADTKRRSGNESAAIWVSQIRDAAYEAENVLEVVDHMEKRNRLKKGFMGAVSRYARLPSDLITLHKVGIEIERIRRKVSEISESANRLKILDLGNDELENSHLGDESPQDYRLVHQNFEDVTVVVGFEDEQKEIVEELVEKDGKLSVVSIVGMGGAGKTTLARKVYTSDKIKQRFETIAWVTVSQKFKGADLLKDIMKQIMGSEYKPRQIDQLEEYELGGKIQNFLVQKKNRSLVPRGS | ||||||